PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_857D5AAEB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 246aa    MW: 26276.3 Da    PI: 6.697
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_857D5AAEB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.54e-5329125197
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdr++Pianv+rim++vlP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl++yl+
  Traes_6AL_857D5AAEB.1  29 VREQDRLMPIANVIRIMRRVLPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSIYLH 116
                            69************************************************************************************** PP

                  NF-YB  89 kyrelegek 97 
                            ++re+ege 
  Traes_6AL_857D5AAEB.1 117 RFREFEGEA 125
                            ******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-4926135IPR009072Histone-fold
SuperFamilySSF471132.64E-3832137IPR009072Histone-fold
PfamPF008082.8E-253699IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-166381No hitNo description
PROSITE patternPS0068506682IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-1682100No hitNo description
PRINTSPR006152.0E-16101119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDMGFPGAAN GAAAAAAGNG GGGGQAPAVR EQDRLMPIAN VIRIMRRVLP PHAKISDDAK  60
ETIQECVSEY ISFITGEANE RCQREQRKTI TAEDVLWAMS RLGFDDYVEP LSIYLHRFRE  120
FEGEARGAGA GHHHHGMPPM MLKPRGAPGP MVPHGDMQMH AAGMYGGGAM PPHPHHPFHM  180
PPHHGQYPQY EMYGGEHGMA AYYGGPYAPG NGGNNGDGSG SSGNGHGGES TPPGGNFEHH  240
QTFGYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4028120193NF-YB
4csr_A3e-4028120294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B3e-4028120294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7269060.0KT726906.1 Hordeum vulgare cultivar Hua30 nuclear factor Y B subunit (HIPP1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624920.11e-92PREDICTED: nuclear transcription factor Y subunit B-10
TrEMBLW5G8C11e-179W5G8C1_WHEAT; Uncharacterized protein
STRINGMLOC_36682.11e-98(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-55nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]